PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 723aa    MW: 81870 Da    PI: 6.2541
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601280.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK461.1e-14536579346
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPh 46 
                     ++i+l++++   s++  +AA +Lgv+ ++LKriCR yGI RWP 
  XP_009601280.1 536 HNINLKKIEDRSSMTQDAAADDLGVGKSTLKRICRLYGITRWPP 579
                     799****************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.946522612IPR003035RWP-RK domain
PfamPF020427.4E-12537580IPR003035RWP-RK domain
SuperFamilySSF542772.71E-13638721No hitNo description
Gene3DG3DSA:3.10.20.2402.6E-13639717No hitNo description
SMARTSM006664.5E-13640722IPR000270PB1 domain
PROSITE profilePS5174518.834640722IPR000270PB1 domain
PfamPF005643.3E-13643721IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MESVFSEQAW SRQPNGIWVF WSERDDVEQL QNHFSFTADV VTKRMAIKER VKIALQHVEK  60
LSCNYLIQYW ASIVIDGQTF LTTSDQPFGL TRLEYGLCSY RKKCLSHAIP VELKNGTQCE  120
NDFGPPGRVF KHRLPELCTD VKNYSQQEFP LRDDAVAWGI QWCYTVPVFD SSRDTFVGVL  180
ELVTSHQTNK WIFQNSVLPI FKTLQVVDLK SPDSYCPLNL KVLDDRQCAL GGLYKAIEVV  240
CQKHQFLFAQ IWVSVADSWC TGKAITVRQR HIAINDNQNL SLFKYASGLQ YILEGYGVVG  300
RAFSSKSSCF CRDVTQLSII EYPLVTCARE AGLTGCFAIC LSAPGNDDNI YILEFFLPPN  360
ELLHWNLQDF VKLVLDTVKQ QLHRFKVAVG HDFGEKLPVE VIKISSDDEL DSFDICQTTK  420
ELHNVEPLPN GGELMLLDTP NQQSFSSETN QQLSLDIDEI NAARDSIAVS EELCNSAGSS  480
TSAETSQNKE RKLQLELSTR QAKQGANAVN KRKNGIRTLT SESEIQKERE RIERDHNINL  540
KKIEDRSSMT QDAAADDLGV GKSTLKRICR LYGITRWPPK NKEKKRKCSH SRKMKSILPA  600
EEDVNASTKF QQSSDSPNKE DTINGAKVGA HVTEIRDGTA VITKVKYGDR MLKLQLTLSS  660
MMKDLEEEVA KRVESSIESF DFTYVDKEGD TILIKCDEDL TECFLHCRSS ENATVKMFIT  720
PKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1578586PKNKEKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601280.10.0PREDICTED: protein NLP7-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13034410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.14e-55Nin-like family protein